Protein Info for PGA1_c29890 in Phaeobacter inhibens DSM 17395

Annotation: histidyl-tRNA synthetase HisS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 495 TIGR00442: histidine--tRNA ligase" amino acids 14 to 460 (447 residues), 391.3 bits, see alignment E=2.7e-121 PF13393: tRNA-synt_His" amino acids 17 to 366 (350 residues), 131.6 bits, see alignment E=5.8e-42 PF00587: tRNA-synt_2b" amino acids 87 to 372 (286 residues), 34.3 bits, see alignment E=3.9e-12 PF03129: HGTP_anticodon" amino acids 384 to 488 (105 residues), 38 bits, see alignment E=2.2e-13

Best Hits

Swiss-Prot: 88% identical to SYH_RUEPO: Histidine--tRNA ligase (hisS) from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)

KEGG orthology group: K01892, histidyl-tRNA synthetase [EC: 6.1.1.21] (inferred from 88% identity to sil:SPO0667)

Predicted SEED Role

"Histidyl-tRNA synthetase (EC 6.1.1.21)" (EC 6.1.1.21)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E4C9 at UniProt or InterPro

Protein Sequence (495 amino acids)

>PGA1_c29890 histidyl-tRNA synthetase HisS (Phaeobacter inhibens DSM 17395)
MAKVKKQPRPKAITPKGFRDYFGEEVSQRSEMLQAIAGVYHRYGFDALESSAVETVEALG
KFLPDVDRPNEGVFAWQEYDEGGNGDWMALRYDLTAPLARVYAQHRNDLPTPYRRYAMGP
VWRNEKPGPGRYRQFYQCDADTVGTASMAADAEICAMLSDTLETVGIPRGDYLVRVNNRK
VLNGVLEAMGLEAGDAKRDDVLRTIDKFDKVGEAGVRELLTKGRLDASGAFIDGVGLSDD
QAAPVLAFLTSKGADAAKTLANLSEAVGSSSIGAEGVGELEQIGDLLAAGGYGADRIDID
PSVVRGLGYYTGPVYEAELTFEILDEKGRKRQFGSVSGGGRYDDLVKRFTGQEVPATGVS
IGVDRLLAALREKGRIKAEATGPVVVTVMDKARMADYQAMVAELRNAGIRAEVYLGNPKN
FGNQLKYADKRNSPIAVIEGGEEKDRGVVQIKDLILGAQIAENATLEEWKERPSQFEVPR
GDLVAKVREILAGQG