Protein Info for HP15_2886 in Marinobacter adhaerens HP15

Annotation: protein of unknown function cysteine-rich region domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02754: CCG
  • amino acids 16 to 96 (81 residues), 51.1 bits, E=6.3e-18
  • amino acids 143 to 227 (85 residues), 47.5 bits, E=7.9e-17

Best Hits

Swiss-Prot: 44% identical to LUTA_BACSK: Lactate utilization protein A (lutA) from Bacillus clausii (strain KSM-K16)

KEGG orthology group: None (inferred from 61% identity to azl:AZL_e03850)

MetaCyc: 45% identical to iron-sulfur oxidase subunit used in L-lactate utilization (Bacillus subtilis subtilis 168)
L-lactate dehydrogenase. [EC: 1.1.1.27]

Predicted SEED Role

"Predicted L-lactate dehydrogenase, Fe-S oxidoreductase subunit YkgE" in subsystem Lactate utilization

MetaCyc Pathways

• Bifidobacterium shunt (15/15 steps found)
• homolactic fermentation (11/12 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (15/19 steps found)
• pyruvate fermentation to acetate and (S)-lactate I (4/4 steps found)
• pyruvate fermentation to acetate and lactate II (4/4 steps found)
• heterolactic fermentation (14/18 steps found)
• superpathway of glucose and xylose degradation (13/17 steps found)
• superpathway of anaerobic sucrose degradation (14/19 steps found)
• pyruvate fermentation to (S)-lactate (1/1 steps found)
• L-histidine degradation V (1/2 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (5/13 steps found)

KEGG Metabolic Maps

• Cysteine metabolism
• Glycolysis / Gluconeogenesis
• Propanoate metabolism
• Pyruvate metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.27

Use Curated BLAST to search for 1.1.1.27

Sequence Analysis Tools

See E4PMD8 at UniProt or InterPro

Protein Sequence (259 amino acids)

>HP15_2886 protein of unknown function cysteine-rich region domain protein (Marinobacter adhaerens HP15)
MVDPIKVYPAKPAKVYFYGTCLVDMFYPDAGIAGVELLEREGIEVLFPQNQTCCGQPAYT
SGYHDEARSVARAQLDLFPGDWPIVVPSGSCGGMMRKHYPDLFEDTTDEVKAAEVAGRVW
ELTDFLLNVCHIKLEDLGEPTTVAMHTSCSARREMGVAEVGPKLLGQLKNVNLVEQIRPE
ECCGFGGTFAVRHPEISSAMVSEKVDALVDTGTRQFVTTDCGCLMNIAGYAEKNQKPVEG
QHILSFLWSRTQGKGGQQS