Protein Info for PGA1_c03060 in Phaeobacter inhibens DSM 17395

Annotation: aspartate carbamoyltransferase PyrB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 PF02729: OTCace_N" amino acids 16 to 158 (143 residues), 147.4 bits, see alignment E=3.4e-47 TIGR00670: aspartate carbamoyltransferase" amino acids 16 to 313 (298 residues), 295.9 bits, see alignment E=1.5e-92 PF00185: OTCace" amino acids 167 to 312 (146 residues), 74.4 bits, see alignment E=1.1e-24

Best Hits

Swiss-Prot: 91% identical to PYRB_RUEPO: Aspartate carbamoyltransferase (pyrB) from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)

KEGG orthology group: K00609, aspartate carbamoyltransferase catalytic subunit [EC: 2.1.3.2] (inferred from 91% identity to sit:TM1040_3070)

Predicted SEED Role

"Aspartate carbamoyltransferase (EC 2.1.3.2)" in subsystem De Novo Pyrimidine Synthesis (EC 2.1.3.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.3.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DX64 at UniProt or InterPro

Protein Sequence (331 amino acids)

>PGA1_c03060 aspartate carbamoyltransferase PyrB (Phaeobacter inhibens DSM 17395)
MPTATSSPDPMAFSQRHLLGIEPLKPHEITAILDLADSYAELNRRPDKHANALSGLTQVN
MFFENSTRTQASFEIAGKRLGADVMNMAMQASSIKKGETLIDTAMTLNAMHPDLLVVRHP
HSGAVDLLAQKVNCAVLNAGDGRHEHPTQALLDALTIRRAKGRLHRLNIAICGDVAHSRV
ARSNLILLGKMENRIRLIGPPTLVPGHFADFGAEIYDDMREGLKDVDVVMMLRLQKERMD
GGFIPSEREYYHRYGLDAEKLALAKPDAIVMHPGPMNRGVEIDGTLADDINRSVIQEQVE
MGVAVRMAAMDLLARNLRASRERAASQPGVA