Protein Info for Psest_2988 in Pseudomonas stutzeri RCH2

Annotation: aspartate kinase, monofunctional class

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00656: aspartate kinase, monofunctional class
  • amino acids 1 to 403 (403 residues), 442.9 bits, E=1.2e-136
• PF00696: AA_kinase
  • amino acids 3 to 229 (227 residues), 175.5 bits, E=2.2e-55
• TIGR00657: aspartate kinase
  • amino acids 63 to 402 (340 residues), 397.3 bits, E=1e-122
• PF01842: ACT
  • amino acids 267 to 324 (58 residues), 37.5 bits, E=2.5e-13
• PF13840: ACT_7
  • amino acids 338 to 398 (61 residues), 61.9 bits, E=6.4e-21

Best Hits

Swiss-Prot: 99% identical to AKLYS_PSEU5: Aspartate kinase Ask_LysC (lysC) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K00928, aspartate kinase [EC: 2.7.2.4] (inferred from 99% identity to psa:PST_1370)

MetaCyc: 72% identical to aspartokinase (Halomonas elongata DSM 2581)
Aspartate kinase. [EC: 2.7.2.4]

Predicted SEED Role

"Aspartokinase (EC 2.7.2.4)" in subsystem Lysine Biosynthesis DAP Pathway or Threonine and Homoserine Biosynthesis (EC 2.7.2.4)

MetaCyc Pathways

• aspartate superpathway (22/25 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• superpathway of L-methionine biosynthesis (by sulfhydrylation) (12/12 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (16/18 steps found)
• L-lysine biosynthesis I (9/9 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• superpathway of L-threonine biosynthesis (6/6 steps found)
• ectoine biosynthesis (5/5 steps found)
• L-lysine biosynthesis III (6/7 steps found)
• L-lysine biosynthesis VI (6/7 steps found)
• L-homoserine biosynthesis (3/3 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (7/9 steps found)
• superpathway of L-methionine biosynthesis (transsulfuration) (7/9 steps found)
• superpathway of L-homoserine and L-methionine biosynthesis (6/8 steps found)
• dipicolinate biosynthesis (3/4 steps found)
• spermidine biosynthesis II (3/4 steps found)
• norspermidine biosynthesis (4/6 steps found)
• L-lysine biosynthesis II (6/9 steps found)
• chorismate biosynthesis II (archaea) (8/12 steps found)
• superpathway of polyamine biosynthesis III (5/8 steps found)
• L-methionine biosynthesis IV (2/4 steps found)
• 3-dehydroquinate biosynthesis II (archaea) (3/7 steps found)
• cremeomycin biosynthesis (2/7 steps found)
• grixazone biosynthesis (2/8 steps found)
• platensimycin biosynthesis (6/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of plant hormones
• Glycine, serine and threonine metabolism
• Lysine biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.7.2.4

Use Curated BLAST to search for 2.7.2.4

Sequence Analysis Tools

See L0GNY5 at UniProt or InterPro

Protein Sequence (412 amino acids)

>Psest_2988 aspartate kinase, monofunctional class (Pseudomonas stutzeri RCH2)
MALIVQKFGGTSVGTVERIEQVAEKVKKFREGGDDIVVVVSAMSGETNRLIDLAKQISEQ
PVPRELDVMVSTGEQVTIALLAMALIKRGVPAVSYTGNQVRILTDSAHTKARILQIDGQR
IQRDIKAGRVVVVAGFQGVDEKGNITTLGRGGSDTTGVALAAALKADECQIYTDVDGVYT
TDPRVVAKAQRLDKITFEEMLEMASLGSKVLQIRAVEFAGKYSVPLRVLHSFQEGPGTLI
TLDEEESMEQPIISGIAFNRDEAKLTIRGVPDTPGVAFKILGPISAANVEVDMIVQNVAH
DNTTDFTFTVHRNDYNNALQVLQGIAAEMGAREVIGDTDIAKVSIVGVGMRSHAGVASRM
FEALAKENINIQMISTSEIKVSVVIEEKYLELAVRALHTAFELDAPAGNTAE