Protein Info for Psest_0294 in Pseudomonas stutzeri RCH2

Annotation: Putative transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 189 PF02622: DUF179" amino acids 18 to 176 (159 residues), 155.7 bits, see alignment E=5e-50

Best Hits

Swiss-Prot: 91% identical to Y3956_PSEU5: UPF0301 protein PST_3956 (PST_3956) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K07735, putative transcriptional regulator (inferred from 91% identity to psa:PST_3956)

Predicted SEED Role

"UPF0301 protein YqgE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GHK9 at UniProt or InterPro

Protein Sequence (189 amino acids)

>Psest_0294 Putative transcriptional regulator (Pseudomonas stutzeri RCH2)
MKSTAPSYLKHHFLIAMPQMADPNFAQTLIYLIEHGAEGAMGLIINRPNGLSLADVLEQL
RPDGPIPSLCQSLPIFSGGPVQTDRGFVLHSADHQFQATLALGPLGMSTSQDVLFAIADG
QGPARHFIALGYAGWEAGQLEAELADNAWLSCPASTEILFDLPYDQRLNAAAASLGVDLR
LLSTQVGHA