Protein Info for PGA1_c29750 in Phaeobacter inhibens DSM 17395

Annotation: putative ribosomal RNA large subunit methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 156 PF02590: SPOUT_MTase" amino acids 1 to 154 (154 residues), 155.6 bits, see alignment E=5.1e-50

Best Hits

Swiss-Prot: 81% identical to RLMH_RUEST: Ribosomal RNA large subunit methyltransferase H (rlmH) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K00783, hypothetical protein (inferred from 81% identity to sit:TM1040_2505)

Predicted SEED Role

"LSU m3Psi1915 methyltransferase RlmH" in subsystem Ribosome biogenesis bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DU76 at UniProt or InterPro

Protein Sequence (156 amino acids)

>PGA1_c29750 putative ribosomal RNA large subunit methyltransferase (Phaeobacter inhibens DSM 17395)
MKVHFCVVGRLRASPEKQLIDDYIERFDRTGRALGLGPCRITEVEDKKNAGMAAEAELLR
KAIPKGAVICTLDERGKLLSSPDFSKRLADWRDTGRQDVAFVIGGADGIDPSLRAEADFS
ISLGKMVWPHMLVRVLLAEQIYRAATILAGSPYHRV