Protein Info for PGA1_c29620 in Phaeobacter inhibens DSM 17395

Annotation: putative CDP-diacylglycerol--serine O-phosphatidyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 40 to 58 (19 residues), see Phobius details amino acids 79 to 97 (19 residues), see Phobius details amino acids 103 to 122 (20 residues), see Phobius details amino acids 142 to 162 (21 residues), see Phobius details amino acids 168 to 186 (19 residues), see Phobius details amino acids 205 to 235 (31 residues), see Phobius details PF01066: CDP-OH_P_transf" amino acids 17 to 168 (152 residues), 82.9 bits, see alignment E=1.7e-27

Best Hits

KEGG orthology group: K00998, phosphatidylserine synthase [EC: 2.7.8.8] (inferred from 67% identity to pde:Pden_4691)

Predicted SEED Role

"CDP-diacylglycerol--serine O-phosphatidyltransferase (EC 2.7.8.8)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EQM0 at UniProt or InterPro

Protein Sequence (250 amino acids)

>PGA1_c29620 putative CDP-diacylglycerol--serine O-phosphatidyltransferase (Phaeobacter inhibens DSM 17395)
MHHPPEKRKSEYALIQLLPNMMTIAAICAGLSAIRFGVQGNYTLAVQLILAAAILDGFDG
RLARILRSDSKMGAELDSLADFLNFGVASPLVIYYWALQDMRGLGWLAVLVFSVCCVVRL
ARFNVSTKSEKKVTAKSVYFEGVPSPAGALLAMLPMFISFAFADAPVIPDILICLHMGVI
GLLMISHVPTWSLKAVKISRENVKYFLVGFAFAGAAVLIYAWITLVILCLGYAAMVAWGL
VKKKTPETGA