Protein Info for PGA1_c29610 in Phaeobacter inhibens DSM 17395

Annotation: phosphatidylethanolamine N-methyltransferase PmtA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 208 PF01135: PCMT" amino acids 32 to 142 (111 residues), 23.3 bits, see alignment E=2e-08 PF01209: Ubie_methyltran" amino acids 33 to 142 (110 residues), 59.7 bits, see alignment E=1.1e-19 PF13489: Methyltransf_23" amino acids 39 to 144 (106 residues), 61.5 bits, see alignment E=3.4e-20 PF13847: Methyltransf_31" amino acids 40 to 145 (106 residues), 70.5 bits, see alignment E=5.5e-23 PF07021: MetW" amino acids 42 to 134 (93 residues), 21.9 bits, see alignment E=5e-08 PF13649: Methyltransf_25" amino acids 44 to 137 (94 residues), 81.3 bits, see alignment E=2.8e-26 PF08241: Methyltransf_11" amino acids 45 to 141 (97 residues), 88.2 bits, see alignment E=1.9e-28 PF08242: Methyltransf_12" amino acids 45 to 138 (94 residues), 67.9 bits, see alignment E=4.4e-22

Best Hits

Swiss-Prot: 56% identical to PMTA_RHOSH: Phosphatidylethanolamine N-methyltransferase (pmtA) from Rhodobacter sphaeroides

KEGG orthology group: K00551, phosphatidylethanolamine N-methyltransferase [EC: 2.1.1.17] (inferred from 66% identity to sil:SPOA0294)

Predicted SEED Role

"Phosphatidylethanolamine N-methyltransferase (EC 2.1.1.17)" (EC 2.1.1.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F083 at UniProt or InterPro

Protein Sequence (208 amino acids)

>PGA1_c29610 phosphatidylethanolamine N-methyltransferase PmtA (Phaeobacter inhibens DSM 17395)
MDIKAVESSYARWAPVYDKTFGAITNVGRRRAVGYVNEHRSGRVLEVGVGTGLSLPLYKS
HLKVTGIDFSEDMLRKAKKRVAENKLHHVEALRQMDARALDFPDATFDTVSAMHVLSVVP
DPEQVMGEIARVLKPGGKVVITNHFLREQGVLAFLERVSAPFANVLGWHSDFEIDTVLGA
DHLSVEHHQPLPPFGLMTFLVLSKIKPV