Protein Info for HP15_2851 in Marinobacter adhaerens HP15

Annotation: transmembrane transport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 379 transmembrane" amino acids 18 to 37 (20 residues), see Phobius details amino acids 49 to 67 (19 residues), see Phobius details amino acids 74 to 95 (22 residues), see Phobius details amino acids 107 to 126 (20 residues), see Phobius details amino acids 133 to 152 (20 residues), see Phobius details amino acids 173 to 196 (24 residues), see Phobius details amino acids 208 to 229 (22 residues), see Phobius details amino acids 241 to 260 (20 residues), see Phobius details amino acids 266 to 284 (19 residues), see Phobius details amino acids 304 to 324 (21 residues), see Phobius details amino acids 330 to 347 (18 residues), see Phobius details PF07690: MFS_1" amino acids 4 to 122 (119 residues), 48.7 bits, see alignment E=8e-17 amino acids 182 to 350 (169 residues), 63.5 bits, see alignment E=2.6e-21 PF00083: Sugar_tr" amino acids 15 to 124 (110 residues), 30.1 bits, see alignment E=3.8e-11

Best Hits

KEGG orthology group: None (inferred from 62% identity to ttu:TERTU_1692)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PMA3 at UniProt or InterPro

Protein Sequence (379 amino acids)

>HP15_2851 transmembrane transport protein (Marinobacter adhaerens HP15)
MNTLLAVTANEQGFSTARIGVIMSGFFVGFACGIFISGRLIRRMGHIRTFAFCAAVCASI
ALLHSLWVDPWAWMALRFLYGLSLVTLMTVTESWLNARAEKHERGRVFAMYMVVNLGGIA
LAQQLLRLSPGELLVLFSVSAILSCWALLPITISSRSQPHIPERAKSSLKKIIGFAPLAV
ATSALSGLAMGAFWAMAPLYASKLGFGLSEVGLLMSLTIVGGALLQIPIGRFSDTQDRRK
VLVVVAALAAGMCLMMPLAWSNTSLMAVFFVWGGLSFSLYPLGVAQLLDQLHPDEVVSGS
TDMLVLHGAGAALAPLLVGLIMNLVGPQGMPVYMAVVLGLLATYAIYQVRHVSVLTAGEQ
AHFEPMAQSSHEIVEMIER