Protein Info for Psest_2959 in Pseudomonas stutzeri RCH2

Annotation: flagellar hook-associated protein FlgK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 671 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details TIGR02492: flagellar hook-associated protein FlgK" amino acids 4 to 360 (357 residues), 266.6 bits, see alignment E=2.8e-83 PF00460: Flg_bb_rod" amino acids 7 to 34 (28 residues), 22.6 bits, see alignment (E = 1.7e-08) PF22638: FlgK_D1" amino acids 93 to 324 (232 residues), 276.8 bits, see alignment E=3e-86 PF21158: flgK_1st_1" amino acids 346 to 424 (79 residues), 40.9 bits, see alignment E=3.5e-14 PF06429: Flg_bbr_C" amino acids 631 to 668 (38 residues), 29.4 bits, see alignment 9e-11

Best Hits

KEGG orthology group: K02396, flagellar hook-associated protein 1 FlgK (inferred from 70% identity to pfv:Psefu_3097)

Predicted SEED Role

"Flagellar hook-associated protein FlgK" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GNU9 at UniProt or InterPro

Protein Sequence (671 amino acids)

>Psest_2959 flagellar hook-associated protein FlgK (Pseudomonas stutzeri RCH2)
MADLLSIGLSGLAASKTQLSITGHNITNVNTPGYSRQDATQATRSPQFSGAGYIGSGTTL
VEVRRSYSEFLTSQLRSSTSLSADVEAYKSQINQLDSLLAGTTTGITPSLQKFFSALQTA
AEDPANIPARQLVLAEAEGLARRFNTVYDRLSEQNNFTNKQMSAVTDQVNRLAGSIGSLN
EAIAIAAANGKQPNDLLDARDEAVRQLSGYIGVTVVPQDDSSFNIFIGSGQPLVVGSTVA
RLEVVPGQGDPNRHEVQFISGGSRQGITSQITGGELGGLIRYREEVLDSTMNSLGRLALA
VSDQVNTQLGQGLDLKGQVGSALFGDYNDPALAKLRVNAFAGNSSAQPVLNITNTSQLST
SDYLMEYDGSSFKIRRLSDNQLMTATENPAGTLSITDKNGRDQGFQIVLGNPPPAPGDKF
SLQPTRRGASDIKATLDQADQLAFAAPVRAQSTLQNSGTGVIGQPNLLSAPSPINAAALS
AAFEGLTLSYDGNGLTLPAPAPAGLTLSPSSITAGQTNTLNLTLTTGTAPNVQQYSFEFT
VSGRPETGDTFSFNFNQSGVSDNRNALKLVDLQTKQTVGVTPGVAGSGFSFTDGYGELVE
RVGTLTAQARMDSEATGAILKQATDNRDSLSAVNLDEEAANLIKFEQYYNASAQIIQVAR
SLFDTLISSFR