Protein Info for Psest_2958 in Pseudomonas stutzeri RCH2

Annotation: flagellar hook-associated protein 3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 TIGR02550: flagellar hook-associated protein 3" amino acids 2 to 419 (418 residues), 322.8 bits, see alignment E=2e-100 PF00669: Flagellin_N" amino acids 3 to 139 (137 residues), 88.4 bits, see alignment E=2.6e-29

Best Hits

KEGG orthology group: K02397, flagellar hook-associated protein 3 FlgL (inferred from 53% identity to pap:PSPA7_4290)

Predicted SEED Role

"Flagellar hook-associated protein FlgL" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GNA6 at UniProt or InterPro

Protein Sequence (422 amino acids)

>Psest_2958 flagellar hook-associated protein 3 (Pseudomonas stutzeri RCH2)
MRISTVQAFNNGVAGLQRNYANATRTQEQISTGNRILTPADDPVASVRLLQLEQQQNVLS
QYNSNLTAAKNSLTQEEVTLNSVNTVLQRVRELAVQAGNGGLSADDRKSIAAELTEREDE
LLSLMNTRNARGEYLFSGFQGKTQPFVRDGAGSYSYQGDEGQRKLQIASSLNIAISDSGK
SIFENVTNAGRYLSSLDITGQPGSTLRVSTPLVQDEVAISGNPPFPAAGVGVRFTSDTEY
VVYDLAAAPDFANPPIDPNLVLASGVVDQQEKTTEKLVFRGVVVQFDGIPVGGETVEVQL
DPAVQKQGILETISNLRKALEDPSSGNAGVRDAVAVALTNLDHGMISVDAARGNIGARLN
VIETTQTDNEDVTLVNKAVQAELRELDYAEALSRLSFQTIILEAAQQSYVKISGLNLFNA
MR