Protein Info for Psest_2956 in Pseudomonas stutzeri RCH2

Annotation: Uncharacterized conserved protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 transmembrane" amino acids 66 to 85 (20 residues), see Phobius details amino acids 91 to 108 (18 residues), see Phobius details PF06803: DUF1232" amino acids 71 to 106 (36 residues), 50.1 bits, see alignment 9.3e-18

Best Hits

KEGG orthology group: None (inferred from 80% identity to psa:PST_1408)

Predicted SEED Role

"DUF1232 domain-containing protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GQ63 at UniProt or InterPro

Protein Sequence (150 amino acids)

>Psest_2956 Uncharacterized conserved protein (Pseudomonas stutzeri RCH2)
MKAPWNLLRYLPLAQRLIKRGKIPALLLAVARKSSSKRGLLKGLREDLALLQALCVAWWR
GEYRAINPNALIAVVAGLLYFLSPIDAIPDWLPGLGFVDDLAVLGWVMRKWSGEMEAFKA
WKQAQSAERQAGLLRLPALDEPQGDDSPQV