Protein Info for PGA1_c03020 in Phaeobacter inhibens DSM 17395

Annotation: dihydroorotase PyrC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 TIGR00857: dihydroorotase, multifunctional complex type" amino acids 22 to 434 (413 residues), 309.3 bits, see alignment E=2.2e-96 PF01979: Amidohydro_1" amino acids 67 to 432 (366 residues), 46.2 bits, see alignment E=3.9e-16 PF07969: Amidohydro_3" amino acids 354 to 433 (80 residues), 38.8 bits, see alignment E=8.4e-14

Best Hits

Swiss-Prot: 38% identical to PYRC_DESAH: Dihydroorotase (pyrC) from Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2)

KEGG orthology group: K01465, dihydroorotase [EC: 3.5.2.3] (inferred from 88% identity to sit:TM1040_3072)

Predicted SEED Role

"Dihydroorotase (EC 3.5.2.3)" in subsystem De Novo Pyrimidine Synthesis (EC 3.5.2.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.2.3

Use Curated BLAST to search for 3.5.2.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EW48 at UniProt or InterPro

Protein Sequence (436 amino acids)

>PGA1_c03020 dihydroorotase PyrC (Phaeobacter inhibens DSM 17395)
MTTLFTNARLIDPEAGTDSIGAVLVQNGRIAAVDKNGTGSDQLFRTRNIGAEDVTLIDCR
GKCLAPGIVDIGVKVCEPGERHKESYKSAGLAAAAGGVTTMVTRPDTTPSIDSPETLEFV
TRRAQADAPVNVLPMAALTKGRAGREMTEIGFLMDAGAVAFSDCDHVVADTKVFSRALSY
ARSCGALVIAHPQEPGLSKGAAATSGKFATLRGLPAVTAMAERMGLDRDIALLEMTGARY
HADQITTARALPALQRAKANGLDITAGTSIHHLTLNELDVADYRTFFKVKPPLRSEEDRL
ALIEALREGLIDTISSMHTPQDEESKRLPFEEAAAGAVALETLLPAALRLYHAEQLDLPT
LFRAMALNPAKRLGLDCGRLSEGAPADLVLFDADQPFVMDRFALHSKSQNTPFDGQRMQG
RVLATYVAGEPVYRRD