Protein Info for HP15_2841 in Marinobacter adhaerens HP15

Annotation: conserved hypothetical protein, secreted

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 531 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF12708: Pectate_lyase_3" amino acids 75 to 251 (177 residues), 29.4 bits, see alignment E=9.9e-11 TIGR03805: parallel beta-helix repeat-containing protein" amino acids 87 to 407 (321 residues), 316.1 bits, see alignment E=2.2e-98 PF13229: Beta_helix" amino acids 128 to 261 (134 residues), 52.2 bits, see alignment E=8.8e-18 PF05048: NosD" amino acids 132 to 325 (194 residues), 42.4 bits, see alignment E=8.3e-15 TIGR03804: parallel beta-helix repeat" amino acids 196 to 232 (37 residues), 29.1 bits, see alignment 6.3e-11 amino acids 213 to 255 (43 residues), 26.9 bits, see alignment 3e-10

Best Hits

Predicted SEED Role

"FIG01057881: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PM93 at UniProt or InterPro

Protein Sequence (531 amino acids)

>HP15_2841 conserved hypothetical protein, secreted (Marinobacter adhaerens HP15)
MRQARTFKKRLLVTAIAGSVLLSGCGGDDGQDGVDGKDGVDGQPADVVAELAVTTSGFSI
PEGAILVAPDAADGDDITEALSVALFDLPEDALVVLPKGRFVVTESIVVNSASGLTLTGH
GINETALDFSNSNGDDAFRFQGGNGITVRDFGVYEAPKNGIKATNVNGIHMTHTATVWEG
ELEANNGAYGLYPLKSQNVLLENNYAFGSADAGIYVGQSENIVVRNNTAKQNVAGIEIEN
STMADVYNNIALGNSGGILVFDLPGLDKAYGGNVRVFNNQAYSNNADNVGAGVVGLVPPG
TGALVLATSDVEIYNNQITDNDTTAVAITSYLLVDDDLPSYPANYGATIGNGWSPTLKNV
YLHNNTIARNGGNPRGALLQPIIDGYASNMNSKGTPQTFPAILYDGIGELLSNAGELAAF
NALVGAEAQADGVNYDPYGPGDQICANSNINGNPAPDYDEVNTGLVYPDDPAQITMVDGS
GNPLPHLLIDQMVNNTFLNCVQPRLAPAVVNFRNNIYGCTGDDLAEAACAL