Protein Info for Psest_2946 in Pseudomonas stutzeri RCH2

Annotation: septum site-determining protein MinD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 TIGR01968: septum site-determining protein MinD" amino acids 2 to 267 (266 residues), 379.8 bits, see alignment E=3.2e-118 PF10609: ParA" amino acids 2 to 245 (244 residues), 52.2 bits, see alignment E=1.8e-17 PF13614: AAA_31" amino acids 2 to 150 (149 residues), 61.4 bits, see alignment E=3.2e-20 PF06564: CBP_BcsQ" amino acids 3 to 148 (146 residues), 24.7 bits, see alignment E=4.6e-09 PF09140: MipZ" amino acids 4 to 141 (138 residues), 34 bits, see alignment E=6.2e-12 PF02374: ArsA_ATPase" amino acids 5 to 40 (36 residues), 31.9 bits, see alignment 2.6e-11 PF01656: CbiA" amino acids 5 to 226 (222 residues), 71.4 bits, see alignment E=2.1e-23

Best Hits

Swiss-Prot: 75% identical to MIND_ECOL6: Septum site-determining protein MinD (minD) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K03609, septum site-determining protein MinD (inferred from 94% identity to pmk:MDS_1268)

Predicted SEED Role

"Septum site-determining protein MinD" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GQ52 at UniProt or InterPro

Protein Sequence (271 amino acids)

>Psest_2946 septum site-determining protein MinD (Pseudomonas stutzeri RCH2)
MAKIIVVTSGKGGVGKTTTSAAIGTGLALRGHKTVIVDFDVGLRNLDLIMGCERRVVYDF
VNVINGDASLTQALIKDKRLENLFVLAASQTRDKDALTQEGVGKVIDELSKNFEYVICDS
PAGIEKGAHLAMYFADEAIVVTNPEVSSVRDSDRMLGLLASKSRRAESGEEPIKEHLLLT
RYNPERVTKGEMLGVEDVEEILSIRLLGVIPESQAVLKASNQGIPVILDDQSDAGQAYSD
AVDRLLGKEVAHRFLDVKKPGFLQRLFGGRE