Protein Info for PGA1_c03010 in Phaeobacter inhibens DSM 17395
Annotation: glycerol-3-phosphate acyltransferase PlsY
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 78% identical to PLSY_RUEST: Glycerol-3-phosphate acyltransferase (plsY) from Ruegeria sp. (strain TM1040)
KEGG orthology group: K08591, glycerol-3-phosphate acyltransferase PlsY [EC: 2.3.1.15] (inferred from 78% identity to sit:TM1040_3073)Predicted SEED Role
"Acyl-phosphate:glycerol-3-phosphate O-acyltransferase PlsY" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria
MetaCyc Pathways
- phosphatidylglycerol biosynthesis I (6/6 steps found)
- phosphatidylglycerol biosynthesis II (6/6 steps found)
- superpathway of phospholipid biosynthesis III (E. coli) (10/12 steps found)
- CDP-diacylglycerol biosynthesis I (4/4 steps found)
- CDP-diacylglycerol biosynthesis II (4/4 steps found)
- oleate biosynthesis III (cyanobacteria) (2/3 steps found)
- superpathway of cardiolipin biosynthesis (bacteria) (9/13 steps found)
- phosphatidate biosynthesis (yeast) (3/5 steps found)
- palmitoyl ethanolamide biosynthesis (2/6 steps found)
- superpathway of stearidonate biosynthesis (cyanobacteria) (2/6 steps found)
- diacylglycerol and triacylglycerol biosynthesis (2/7 steps found)
- stigma estolide biosynthesis (2/7 steps found)
- anandamide biosynthesis II (2/8 steps found)
- anandamide biosynthesis I (3/12 steps found)
- superpathway of phospholipid biosynthesis II (plants) (11/28 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 2.3.1.15
Use Curated BLAST to search for 2.3.1.15
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See I7DX60 at UniProt or InterPro
Protein Sequence (201 amino acids)
>PGA1_c03010 glycerol-3-phosphate acyltransferase PlsY (Phaeobacter inhibens DSM 17395) MPPIETAAPVLLLWAVIGYALGSIPFGLLLTRIMGLGNLRSIGSGNIGTTNVLRTGSKKA AALTLLLDGGKGAVAVLLARTLAGEDAAQLAGLAAFLGHCYPIWLKFQGGKGVATFLGLM LALAWPVGIACCLTWLAAAYLSKISSMGALVSAVAAPLWCLLLGAPITTGLAALLAAIIL WRHKENIARLRMGTEPKIGQK