Protein Info for PGA1_c03010 in Phaeobacter inhibens DSM 17395

Annotation: glycerol-3-phosphate acyltransferase PlsY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 201 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 61 to 81 (21 residues), see Phobius details amino acids 87 to 105 (19 residues), see Phobius details amino acids 116 to 140 (25 residues), see Phobius details amino acids 154 to 181 (28 residues), see Phobius details TIGR00023: acyl-phosphate glycerol 3-phosphate acyltransferase" amino acids 11 to 201 (191 residues), 179 bits, see alignment E=4.7e-57 PF02660: G3P_acyltransf" amino acids 17 to 190 (174 residues), 186.4 bits, see alignment E=2.2e-59

Best Hits

Swiss-Prot: 78% identical to PLSY_RUEST: Glycerol-3-phosphate acyltransferase (plsY) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K08591, glycerol-3-phosphate acyltransferase PlsY [EC: 2.3.1.15] (inferred from 78% identity to sit:TM1040_3073)

Predicted SEED Role

"Acyl-phosphate:glycerol-3-phosphate O-acyltransferase PlsY" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.15

Use Curated BLAST to search for 2.3.1.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DX60 at UniProt or InterPro

Protein Sequence (201 amino acids)

>PGA1_c03010 glycerol-3-phosphate acyltransferase PlsY (Phaeobacter inhibens DSM 17395)
MPPIETAAPVLLLWAVIGYALGSIPFGLLLTRIMGLGNLRSIGSGNIGTTNVLRTGSKKA
AALTLLLDGGKGAVAVLLARTLAGEDAAQLAGLAAFLGHCYPIWLKFQGGKGVATFLGLM
LALAWPVGIACCLTWLAAAYLSKISSMGALVSAVAAPLWCLLLGAPITTGLAALLAAIIL
WRHKENIARLRMGTEPKIGQK