Protein Info for Psest_2944 in Pseudomonas stutzeri RCH2

Annotation: lipid A biosynthesis lauroyl (or palmitoleoyl) acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 transmembrane" amino acids 15 to 51 (37 residues), see Phobius details amino acids 81 to 98 (18 residues), see Phobius details amino acids 118 to 140 (23 residues), see Phobius details PF03279: Lip_A_acyltrans" amino acids 4 to 294 (291 residues), 278.8 bits, see alignment E=2.5e-87 TIGR02207: lipid A biosynthesis lauroyl (or palmitoleoyl) acyltransferase" amino acids 4 to 303 (300 residues), 431.6 bits, see alignment E=8.7e-134

Best Hits

Swiss-Prot: 46% identical to LPXL_ECOLI: Lipid A biosynthesis lauroyltransferase (lpxL) from Escherichia coli (strain K12)

KEGG orthology group: K02517, lipid A biosynthesis lauroyl acyltransferase [EC: 2.3.1.-] (inferred from 92% identity to psa:PST_1426)

MetaCyc: 46% identical to lauroyl acyltransferase (Escherichia coli K-12 substr. MG1655)
LAUROYLACYLTRAN-RXN [EC: 2.3.1.241]

Predicted SEED Role

"Lipid A biosynthesis lauroyl acyltransferase (EC 2.3.1.-)" in subsystem KDO2-Lipid A biosynthesis (EC 2.3.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.- or 2.3.1.241

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GNR7 at UniProt or InterPro

Protein Sequence (313 amino acids)

>Psest_2944 lipid A biosynthesis lauroyl (or palmitoleoyl) acyltransferase (Pseudomonas stutzeri RCH2)
MDRPQFRAYFLHPRFWPLWLGLGLLWLLVQLPYPLLLQLGRGLGALMFRFAGSRRYIARR
NLELCFPELSQEQRERLLHENFASNGIAFFEMAMSWWWPQARLQRLARIEGLEHLQLAGQ
GVILMALHFTTLEIGAALLGQRHTIDGMYREHKNPVFDFVQRRGRERHNRDASAIEREDV
RAMLKVLRAGRAIWYAPDQDYGRKQSLFVPLFGIQAATVTATTKFARLGRARVVPFTQER
LADGSGYRLVIHPPLEDFPGESEEADCLRINQWVEEAVSALPEQYLWAHRRFKTRPVGEP
GLYTKRSKRSAGR