Protein Info for HP15_2832 in Marinobacter adhaerens HP15

Updated annotation (from data): DNA damage response helicase (yejH or radD)
Rationale: Conserved and specific phenotype: important for resisting cisplatin. Also important for resisting ionizing radiationa and UV radiation in E. coli (PMID:25425430)
Original annotation: type III restriction protein res subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04851: ResIII
  • amino acids 5 to 157 (153 residues), 108.6 bits, E=6.5e-35
• PF00270: DEAD
  • amino acids 8 to 155 (148 residues), 54.4 bits, E=2.7e-18
• PF18766: SWI2_SNF2
  • amino acids 10 to 156 (147 residues), 34.4 bits, E=3.8e-12
• PF00271: Helicase_C
  • amino acids 247 to 346 (100 residues), 53 bits, E=7.7e-18

Best Hits

Swiss-Prot: 62% identical to RADD_ECOLI: Putative DNA repair helicase RadD (radD) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 89% identity to maq:Maqu_2959)

MetaCyc: 62% identical to putative DNA repair helicase RadD (Escherichia coli K-12 substr. MG1655)
Nucleoside-triphosphatase. [EC: 3.6.1.15, 3.6.1.5]

Predicted SEED Role

"ATP-dependent RNA helicase YejH"

MetaCyc Pathways

• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (18/18 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis I (9/9 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (12/14 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis III (8/9 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis IV (6/7 steps found)
• pyrimidine deoxyribonucleotides biosynthesis from CTP (6/8 steps found)
• UTP and CTP dephosphorylation I (5/7 steps found)
• UTP and CTP dephosphorylation II (1/3 steps found)

KEGG Metabolic Maps

• Purine metabolism
• Pyrimidine metabolism
• Thiamine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.15

Use Curated BLAST to search for 3.6.1.15 or 3.6.1.5

Sequence Analysis Tools

See E4PLK5 at UniProt or InterPro

Protein Sequence (585 amino acids)

>HP15_2832 DNA damage response helicase (yejH or radD) (Marinobacter adhaerens HP15)
MNAPFKLRPYQREAVDATLAHFRKTDESAVIVLPTGAGKSLVIAELARLAKRKILVVTHV
KELVEQNHAKYQSYGLTGGIFSAGLKRKESHHQVTFASVQSVSANLDQFRDEYSLVIIDE
CHRVSGEETSQYQRIIELLRQQNDSLKVLGLTATPYRLAMGWIYRYHYRGFVRGEDDKPF
QHCIYELPLSYMINRGYLTRPELVNAAVAQYDFSALPKDRFGEYAERDVNQLLSKHKRVT
RAIIEQVVELAAERQGVMIFAATVEHAREVAGYLPEHETALITGATDLKDRDLLIQRFKQ
RQLKYLVNVSVLTTGFDAPHVDFIAILRPTQSVSLYQQIVGRGLRLDEGKQDCLVIDYAG
NHVNLHHPEVGEPKPNPDSEPVQVFCPGCGFANIFWGKTDDDGRVIEHYGRRCQGLLEPV
DGVQDERPQQCDYRFRFKECPHCGAENDIAARNCHQCHKAIIDPDDQLRDALKLKDAMVI
RCAGISLVADGSKLKITYHGEDGEELGESFDFSKPGQRAVFNKLFGRRFANSQAPKAFSS
ADEVLELEALLPAPDFVIARKQKHYWQVQERVFDYQGQFRKANEV