Protein Info for PGA1_c29340 in Phaeobacter inhibens DSM 17395

Annotation: putative HlyD family secretion protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 transmembrane" amino acids 17 to 46 (30 residues), see Phobius details TIGR01843: type I secretion membrane fusion protein, HlyD family" amino acids 16 to 437 (422 residues), 351.7 bits, see alignment E=3.1e-109 PF13533: Biotin_lipoyl_2" amino acids 64 to 102 (39 residues), 24.5 bits, see alignment 3.8e-09 PF00529: CusB_dom_1" amino acids 70 to 392 (323 residues), 29.9 bits, see alignment E=8.8e-11 PF13437: HlyD_3" amino acids 289 to 390 (102 residues), 41.3 bits, see alignment E=4.7e-14

Best Hits

Swiss-Prot: 42% identical to PRSE_RHIME: Type I secretion system membrane fusion protein PrsE (prsE) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K02022, (no description) (inferred from 74% identity to sit:TM1040_2478)

Predicted SEED Role

"Type I secretion membrane fusion protein, HlyD family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F2I3 at UniProt or InterPro

Protein Sequence (438 amino acids)

>PGA1_c29340 putative HlyD family secretion protein (Phaeobacter inhibens DSM 17395)
MNQSKTETNSWSARRPLIIGLIGVIILLGGFGTWSVATSIAGAVVASGRIEVDRNRQVVQ
HLDGGIVQEILVEEGDTVAEGAVLLRLDAKELRSQLVITEGQLFELMARRARLDAERDSA
ETVEFDTELHDLSETRPEVADLMQGQVRLFEARKDSVAREIDQLEKRRTQIQDQIIGVRA
QQASRRTQLDLIEEELTNQQSLLDRGLAQAGTVLNLRRTEADLQGSLGELIATEAQAEGR
ITEIDIEILKLGTQQREEAITRLRDLRYQELELAETRRALKDRLARLDITAPVSGIVYGL
QVHTPRSVIRAADPVLYLVPQDRPLVIAAQVAPTDVDQIFVGQAVTLRFPALDQRSTPEL
FGSVKQISADAFEDQASKLSYYRTEIELNPGQLETLPEGTVLIPGMPVEGYIRTADRTPL
GYLVKPLADYFVRAFRES