Protein Info for PGA1_c29320 in Phaeobacter inhibens DSM 17395

Annotation: putative endoribonuclease L-PSP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 152 PF14588: YjgF_endoribonc" amino acids 4 to 140 (137 residues), 92.1 bits, see alignment E=3.1e-30 PF01042: Ribonuc_L-PSP" amino acids 16 to 147 (132 residues), 66.2 bits, see alignment E=2.7e-22

Best Hits

Swiss-Prot: 47% identical to TCP17_TRYCR: Protein TCP17 (TCP17) from Trypanosoma cruzi

KEGG orthology group: None (inferred from 78% identity to sit:TM1040_2477)

Predicted SEED Role

"Bona fide RidA/YjgF/TdcF/RutC subgroup"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E477 at UniProt or InterPro

Protein Sequence (152 amino acids)

>PGA1_c29320 putative endoribonuclease L-PSP (Phaeobacter inhibens DSM 17395)
MDIEAKLKDLGIQLPSAPAPAANYVPYVVVDNMVYISGQISAGPEGLITGKLGADMDVAA
GQKAARQCAIALLAQLKAACDGDLNRLKRVVKLGAFVNSTDSFTDQPQVVNGASDLMVEV
LGDAGRHARAAVSSPSLPLGVAVEIDGVFQIS