Protein Info for PGA1_c29310 in Phaeobacter inhibens DSM 17395

Annotation: glycerophosphoryl diester phosphodiesterase-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03009: GDPD
  • amino acids 26 to 234 (209 residues), 89.1 bits, E=2.6e-29

Best Hits

KEGG orthology group: None (inferred from 61% identity to sil:SPO3731)

Predicted SEED Role

"Glycerophosphoryl diester phosphodiesterase (EC 3.1.4.46)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (EC 3.1.4.46)

MetaCyc Pathways

• glycerophosphodiester degradation (2/2 steps found)
• glycerol and glycerophosphodiester degradation (3/4 steps found)
• phosphatidylcholine resynthesis via glycerophosphocholine (1/2 steps found)
• phospholipid remodeling (phosphatidylethanolamine, yeast) (2/4 steps found)
• anandamide biosynthesis I (3/12 steps found)

KEGG Metabolic Maps

• Glycerophospholipid metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.4.46

Use Curated BLAST to search for 3.1.4.46

Sequence Analysis Tools

See I7EQK0 at UniProt or InterPro

Protein Sequence (257 amino acids)

>PGA1_c29310 glycerophosphoryl diester phosphodiesterase-like protein (Phaeobacter inhibens DSM 17395)
MTSDLPAAFLRQPITHRALHDVRDGRPENSRAAILAAIEAGYGIEMDLQLSSDGCAMVFH
DYNLERLAEGTGLVADHTRDQLRAIPLKGGDGECIPDLAEVLDLVDGRVPLLIELKDQDG
NMGPNIGALEADTADQLKNYTGEVALMSFNPHSVVELARLAPERPRGLTTSSYRVEHWPE
LTAEVCDHLRAIPDFDRSGSCFISHEVADLASPRVGELRAQGVPVLCWTVTSAAMEKEAR
KIAHNVTFERYLSDIPA