Protein Info for PGA1_c29290 in Phaeobacter inhibens DSM 17395

Annotation: putative pterin 4 alpha carbinolamine dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 97 PF01329: Pterin_4a" amino acids 4 to 95 (92 residues), 103.2 bits, see alignment E=3.5e-34

Best Hits

Swiss-Prot: 78% identical to PHS_ROSDO: Putative pterin-4-alpha-carbinolamine dehydratase (RD1_0944) from Roseobacter denitrificans (strain ATCC 33942 / OCh 114)

KEGG orthology group: K01724, 4a-hydroxytetrahydrobiopterin dehydratase [EC: 4.2.1.96] (inferred from 78% identity to rde:RD1_0944)

MetaCyc: 50% identical to Pterin-4-alpha-carbinolamine dehydratase (Homo sapiens)
4a-hydroxytetrahydrobiopterin dehydratase. [EC: 4.2.1.96]

Predicted SEED Role

"Pterin-4-alpha-carbinolamine dehydratase (EC 4.2.1.96)" in subsystem Pterin biosynthesis (EC 4.2.1.96)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.96

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DU27 at UniProt or InterPro

Protein Sequence (97 amino acids)

>PGA1_c29290 putative pterin 4 alpha carbinolamine dehydratase (Phaeobacter inhibens DSM 17395)
MTEKLSDATRGPLLDPLFSAGWQVVNGRDAITKTYKFDSFVDAFGWMTRAAIWAEKWDHH
PEWSNVYNTVTVTLTTHDVGGISALDAKLARKMESLF