Protein Info for HP15_2827 in Marinobacter adhaerens HP15

Annotation: oxidoreductase, aldo/keto reductase family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 PF00248: Aldo_ket_red" amino acids 16 to 311 (296 residues), 263.2 bits, see alignment E=1.3e-82

Best Hits

Swiss-Prot: 60% identical to GS69_BACSU: Aldo-keto reductase YhdN (yhdN) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 60% identity to csa:Csal_0382)

Predicted SEED Role

"putative aldo/keto reductase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PLK0 at UniProt or InterPro

Protein Sequence (329 amino acids)

>HP15_2827 oxidoreductase, aldo/keto reductase family (Marinobacter adhaerens HP15)
MDKRTFGNTDIQVTPVGLGTWAIGGWMWGGTDEAQSIDTIHRAIDKGIGLVDTAPVYGFG
RSEEIVGKALSDGRRDQVALATKVALNWNDDHDKVWRDASASRIEREVEDSLKRLQTDRI
DIYQVHWPDPKTPMEETARALEKLYQAGKIRAIGVSNFTPSQMDELQKSVPLHSLQPPYN
LFEREIEQDILPYCRENGIATITYGGLCRGFLTGKMREDTQFTGDDLRKNDPKFQGDRYR
QYLNAVAELDAFARERYQKSVLALALRWLVDQPGVTTALWGARRPEQLDPVDEIDGWSLD
KNAMAEIDGILDRCITDPVGPEFMAPPTR