Protein Info for Psest_2938 in Pseudomonas stutzeri RCH2

Annotation: transporter, SSS family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 551 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 35 to 55 (21 residues), see Phobius details amino acids 76 to 98 (23 residues), see Phobius details amino acids 104 to 123 (20 residues), see Phobius details amino acids 149 to 169 (21 residues), see Phobius details amino acids 182 to 201 (20 residues), see Phobius details amino acids 210 to 230 (21 residues), see Phobius details amino acids 263 to 287 (25 residues), see Phobius details amino acids 299 to 324 (26 residues), see Phobius details amino acids 357 to 384 (28 residues), see Phobius details amino acids 406 to 425 (20 residues), see Phobius details amino acids 431 to 451 (21 residues), see Phobius details amino acids 463 to 485 (23 residues), see Phobius details amino acids 498 to 518 (21 residues), see Phobius details PF00474: SSF" amino acids 64 to 470 (407 residues), 418.3 bits, see alignment E=1.7e-129 TIGR00813: transporter, solute:sodium symporter (SSS) family" amino acids 64 to 467 (404 residues), 205.2 bits, see alignment E=9.3e-65

Best Hits

Swiss-Prot: 77% identical to ACTP_YERE8: Cation/acetate symporter ActP (actP) from Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)

KEGG orthology group: K14393, cation/acetate symporter (inferred from 98% identity to psa:PST_1432)

MetaCyc: 76% identical to acetate/glycolate:cation symporter (Escherichia coli K-12 substr. MG1655)
RXN0-1981; RXN0-5111; TRANS-RXN0-576

Predicted SEED Role

"Acetate permease ActP (cation/acetate symporter)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GN72 at UniProt or InterPro

Protein Sequence (551 amino acids)

>Psest_2938 transporter, SSS family (Pseudomonas stutzeri RCH2)
MILRFLMTALLLAVSPALLADAITGEVEKQATNYTAIIMFVVFIAFTMGITKWAAKRNTS
TADYYTAGGSITGFQNGLAIAGDFMSAASFLGISALVYTSGYDGLIYSIGFLVGWPIILF
LMAERLRNLGKFTFSDVASYRLGQTQIRLLSAFGSLIVVAFYLIAQMVGAGKLIQLLFGL
DYYVAVVLVGVLMVMYVLFGGMLATTWVQIIKAVLLLSGASFMAIMVMKSVGFDFGSLFA
EAVKIHEKGAQIMSPGGLVSDPISAISLGLALMFGTAGLPHILMRFFTVSDAKEARKSVF
YATGFIGYFYILTFIIGFGAILLVSTNPEFKDVTGAIVGGTNMVAIHLASAVGGNLFLGF
ISAVAFATILAVVAGLTLAGASAVSHDLYACVIKQGKAREEDEMRVTKLTTLTLGVVAIL
LGIIFEKQNIAFMVGLAFSIAASCNFPVLFLSMYWKGLSTRGALFGGSLGLFTALLLTII
SPTVWVDVFGFAEAIFPYKYPALFSMAAAFAGIWFFSVTDKSKRAGEERERFFAQFVRSQ
TGLGATGAVAH