Protein Info for HP15_287 in Marinobacter adhaerens HP15

Annotation: pyrroline-5-carboxylate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 PF03807: F420_oxidored" amino acids 6 to 101 (96 residues), 68.2 bits, see alignment E=7.7e-23 TIGR00112: pyrroline-5-carboxylate reductase" amino acids 7 to 269 (263 residues), 283.1 bits, see alignment E=1.3e-88 PF14748: P5CR_dimer" amino acids 165 to 269 (105 residues), 125.3 bits, see alignment E=1.2e-40

Best Hits

Swiss-Prot: 45% identical to P5CR_PSEAE: Pyrroline-5-carboxylate reductase (proC) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00286, pyrroline-5-carboxylate reductase [EC: 1.5.1.2] (inferred from 86% identity to maq:Maqu_0535)

Predicted SEED Role

"Pyrroline-5-carboxylate reductase (EC 1.5.1.2)" in subsystem Proline Synthesis (EC 1.5.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PL09 at UniProt or InterPro

Protein Sequence (277 amino acids)

>HP15_287 pyrroline-5-carboxylate reductase (Marinobacter adhaerens HP15)
MSTSPTISFIGAGNMASAIIGGMLDNGYKAGNIWVSAPDDAHLQTIRKRFGVSVTTDNRY
CAQQADMVVLAVKPQVMADVCRDIAPVVQNTRPLMVSIAAGLTADTLDGWLGGGLPMVRV
MPNTPSLVGKGAAGLFANKEVKDKQKKMVESVFESIGSALWVEDENLLHAVTALSGSGPA
YFFLMLEALEEAATEAGIAAGTARELAIQTMAGAAEMAGRSEHDPGQLKRNVMSPGGTTE
QAINTFEEGGMRDLVAKAYKAAFKRSEEMAKELAGKQ