Protein Info for PGA1_c29230 in Phaeobacter inhibens DSM 17395

Annotation: methionine aminopeptidase Map

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00500: methionine aminopeptidase, type I
  • amino acids 13 to 258 (246 residues), 304.2 bits, E=3.5e-95
• PF00557: Peptidase_M24
  • amino acids 23 to 250 (228 residues), 159.9 bits, E=4e-51

Best Hits

Swiss-Prot: 57% identical to MAP1_RICPR: Methionine aminopeptidase (map) from Rickettsia prowazekii (strain Madrid E)

KEGG orthology group: K01265, methionyl aminopeptidase [EC: 3.4.11.18] (inferred from 88% identity to sit:TM1040_2469)

MetaCyc: 53% identical to methionine aminopeptidase (Escherichia coli K-12 substr. MG1655)
Methionyl aminopeptidase. [EC: 3.4.11.18]

Predicted SEED Role

"Methionine aminopeptidase (EC 3.4.11.18)" (EC 3.4.11.18)

MetaCyc Pathways

• Arg/N-end rule pathway (eukaryotic) (8/14 steps found)
• Ac/N-end rule pathway (6/21 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.11.18

Sequence Analysis Tools

See I7F2H5 at UniProt or InterPro

Protein Sequence (269 amino acids)

>PGA1_c29230 methionine aminopeptidase Map (Phaeobacter inhibens DSM 17395)
MRSKDGRTTKDGIRIYEPGDFAGMHAAGALAARILDDIAPHVAPGQSTGELDRMITQMVE
DAGATSATIGYKGYQHASCISVNHVVCHGIPGDKKLKDGDILNIDVTVIVDGWFGDTSRM
YVAGKLSRKTERLIQVTHDSLMKGIEAVKPGNTFGDIGHAIQSYVEAQRMSVVRDFCGHG
LGQVFHAPPNVLHYGRAGSGPVLEEGMFFTIEPMVNLGRPETKILADEWTAVTRDKSLSA
QFEHSVGVTADGAEIFTLSPGGTFHPTYG