Protein Info for HP15_2820 in Marinobacter adhaerens HP15

Annotation: phosphate: Na+ symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 602 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 28 to 46 (19 residues), see Phobius details amino acids 69 to 93 (25 residues), see Phobius details amino acids 99 to 121 (23 residues), see Phobius details amino acids 128 to 146 (19 residues), see Phobius details amino acids 152 to 172 (21 residues), see Phobius details amino acids 192 to 214 (23 residues), see Phobius details amino acids 234 to 256 (23 residues), see Phobius details amino acids 267 to 287 (21 residues), see Phobius details amino acids 307 to 326 (20 residues), see Phobius details PF02690: Na_Pi_cotrans" amino acids 34 to 173 (140 residues), 123.2 bits, see alignment E=4.3e-40 amino acids 201 to 257 (57 residues), 36.8 bits, see alignment 2e-13

Best Hits

KEGG orthology group: K03324, phosphate:Na+ symporter (inferred from 48% identity to dsh:Dshi_0543)

Predicted SEED Role

"Sodium-dependent phosphate transporter" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PLJ3 at UniProt or InterPro

Protein Sequence (602 amino acids)

>HP15_2820 phosphate: Na+ symporter (Marinobacter adhaerens HP15)
MNYRQLFLALILGILALALWVSPEFKQIAAGVAIFLFGMLSLENGFRQFTGGFLESVLRR
TTDTIPKSLGFGIVSTAIMQSSSLVSVITISFLSAGLLPLITGIGIIFGANLGTTTGAWL
FASIGMKMSLSAFALPMLVFGVVLNFQQPRAWKAFGAVLAGLGFLFLGIDFMKAGFESYE
SAVDLREYAMDGVAGLLVYTGLGILATVVMQSSHATLALTLAGLATGQITYENALALAIG
ANIGTTVTALIGGLGANITGKRLAGAHLLFNAVTAVIALVLIEPLRWSVDALSALMSIAD
DDYTIKLALFHTLFNCLGVAIMLPLISRMARALERWLPEREEEVAAQPRYLNQAAMDSPD
SAIAAVRREVWHLFDQAFVILAHGLHLHRENIRQTDDLAAMINNSRERIDIDIDLIYRQR
VKRLYNAILDFISARMTRESPANSTESLYRLQHAASEMVEAIKHVKHLRKNLTIYMASDN
ATIRKEYNELRLRVAMVLRETHRFYEGRFEDASTAILELDEIAVRARVDRESMVGRVTKL
LGAKRIDAAMATSLLNDSAYASETVDAILTGTRELLTAMDVEAARTTEQLSVSDAGRAEV
MP