Protein Info for PGA1_c29190 in Phaeobacter inhibens DSM 17395

Annotation: acetyltransferase (GNAT)-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 PF00583: Acetyltransf_1" amino acids 168 to 232 (65 residues), 35 bits, see alignment E=7.6e-13

Best Hits

KEGG orthology group: None (inferred from 66% identity to sit:TM1040_2466)

Predicted SEED Role

"Histone acetyltransferase HPA2 and related acetyltransferases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DU17 at UniProt or InterPro

Protein Sequence (247 amino acids)

>PGA1_c29190 acetyltransferase (GNAT)-like protein (Phaeobacter inhibens DSM 17395)
MTTAHSLTDPKYYDVTDHTWPAAEIRQLGPVTLRRGAGGGSRVSAATVTTGHASEAEITA
AEQAMSEMGQDHLFMIRDGQDALDAQLAARGYVIKDPVVLWTCPVEPLCHVEIPPVTAFC
VWEPLAIQHEIWAAGGIGPERFAVMQRVEGAKTSLLGRCDDSPGGTGFVAIHGGTAMVHA
LEILSHQRRKGMGVWLMHRAAQWAADQGARELAVLCTEANAGANGLYASLGMLRAGRYHY
RHNPKEV