Protein Info for HP15_2817 in Marinobacter adhaerens HP15

Annotation: MgtC/SapB transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 40 to 60 (21 residues), see Phobius details amino acids 76 to 95 (20 residues), see Phobius details amino acids 107 to 140 (34 residues), see Phobius details PF02308: MgtC" amino acids 15 to 145 (131 residues), 117.3 bits, see alignment E=2.6e-38

Best Hits

KEGG orthology group: K07507, putative Mg2+ transporter-C (MgtC) family protein (inferred from 85% identity to maq:Maqu_2953)

Predicted SEED Role

"Mg(2+) transport ATPase protein C"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PLJ0 at UniProt or InterPro

Protein Sequence (150 amino acids)

>HP15_2817 MgtC/SapB transporter (Marinobacter adhaerens HP15)
MFESEIPPLDIIVRLLMAAGLALVLGLERELRGKPAGLRSHMLVSVGASAFILIGLHILM
TTAEGDPSARIDPSRIVEGVIGGIGFLGAGCIIQSRGSVQGITTGASIWICGAIGVACGL
GTLVLASMVTVLALIIMVVLGRFEREMIEE