Protein Info for Psest_2926 in Pseudomonas stutzeri RCH2

Annotation: TIGR03440 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 TIGR03440: ergothioneine biosynthesis protein EgtB" amino acids 20 to 428 (409 residues), 559.3 bits, see alignment E=3.5e-172 PF12867: DinB_2" amino acids 24 to 157 (134 residues), 31.4 bits, see alignment E=2.3e-11 PF03781: FGE-sulfatase" amino acids 197 to 333 (137 residues), 77.7 bits, see alignment E=1.2e-25 amino acids 340 to 429 (90 residues), 34.8 bits, see alignment E=1.4e-12

Best Hits

KEGG orthology group: None (inferred from 94% identity to psa:PST_1444)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GQ31 at UniProt or InterPro

Protein Sequence (431 amino acids)

>Psest_2926 TIGR03440 family protein (Pseudomonas stutzeri RCH2)
MGNLAEQPHPHPALAELDLLLQRYRQVRATSEAICTPLQVEDYVIQSTPEVSPPKWHLAH
VSWFFETFLLLPYLPGYRRLNDAYDYLFNSYYQTHGLPFPRTSRGVLSRPGVDEIYRYRR
HVDQAMGELLSNPPREQAAEIVRRVGLGLQHEQQHQELLLMDIKHILAQNPLHPVYRHDL
AKPQPSGPERPRWHEFTGGVQHIGHAGNDFAFDCETPRHRQFVEDFQLAERLVSNREYLS
FITDGGYARPELWLSDGWDLIQQAGWNAPLYWLREDSSWHEMTLGGLRTLDLEAPVCHIS
YYEADAYARWAGARLPSEAEWEVAAADQPLRGNFLESDYLQPVAALPGHDGPRQLFGDVW
EWTASAYLPYPGFRPLEGSLGEYNGKFMSGQMVLRGGCCATPESHVRVTYRNFFQPAMRW
QFAGLRLARGL