Protein Info for HP15_2804 in Marinobacter adhaerens HP15

Annotation: oligopeptide/dipeptide ABC transporter, ATP-binding protein-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 672 PF00005: ABC_tran" amino acids 27 to 186 (160 residues), 111.8 bits, see alignment E=2.2e-35 amino acids 378 to 527 (150 residues), 120.5 bits, see alignment E=4.3e-38 TIGR01727: oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain" amino acids 236 to 321 (86 residues), 77.7 bits, see alignment E=8.6e-26 amino acids 576 to 662 (87 residues), 72.5 bits, see alignment E=3.7e-24 PF08352: oligo_HPY" amino acids 237 to 302 (66 residues), 63.9 bits, see alignment E=6.9e-21 amino acids 578 to 643 (66 residues), 66.8 bits, see alignment E=9e-22

Best Hits

Predicted SEED Role

"Oligopeptide transport ATP-binding protein OppF (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PLH7 at UniProt or InterPro

Protein Sequence (672 amino acids)

>HP15_2804 oligopeptide/dipeptide ABC transporter, ATP-binding protein-like protein (Marinobacter adhaerens HP15)
MNMASILDIQDLSVDIPTDSSTLHAVRGISLELNRGETLGIVGESGSGKSMTALALMNLL
PPAAKRQASCIDFDGSDLTHATERELASKIRGQRIGMIFQEPMTSLNPVYSIGRQLKETM
TLHRKVSDTEAENRAVYLLEKVGLPDPASRLKQYPHELSGGQRQRVMIAMALMNEPELLI
ADEPTTALDVTIQAQILHLLRELQQEFGMSMILITHDLGVVSRAADNIAVMYAGDIVETG
KTGEVLENPRHPYTKGLLECVPGYKGQSQQRLGAIPGIVPAMTGDISGCAFASRCPRAAG
VCRTTNPPTKKLHQGRYFVCHEPDVEGRGLAAERPTASERTVTSNVRGTEDILTVDHVSC
TFSVRRGMFGKRKPLQALDDVSLTLKKGEVLALVGESGCGKTTLTRTIMGLQAPSTGSVT
LNGQRIENLPPMDRARMIQPIFQDPYSSLNPRKTIGEIIAKPLFVHGIGSNQEQHQQVRK
MMELVGLPSRVFNSYPDQLSGGQRQRAAIGRALILNPEVVICDEPTSALDVSVQAQILNL
LLDLRDELDLTYLFVTHNLSVVQHMADRVAVMYLGEIVECGERDQVMSDPKHPYTHALMN
SALSISPGESVPDPGLSGDFPNPMNRPSGCPFHPRCPLADQQCREQAPGPELIDNTLVQC
WKARTAGNQLKS