Protein Info for Psest_0287 in Pseudomonas stutzeri RCH2

Annotation: probable DNA metabolism protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 TIGR03915: probable DNA metabolism protein" amino acids 5 to 238 (234 residues), 200.7 bits, see alignment E=1.6e-63 PF13566: DUF4130" amino acids 77 to 238 (162 residues), 129.9 bits, see alignment E=3.6e-42

Best Hits

KEGG orthology group: None (inferred from 81% identity to psa:PST_3963)

Predicted SEED Role

"Domain often clustered or fused with uracil-DNA glycosylase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GDS2 at UniProt or InterPro

Protein Sequence (278 amino acids)

>Psest_0287 probable DNA metabolism protein (Pseudomonas stutzeri RCH2)
MLTVRFDGSFQAWRSRARTLLQSHVAPHEVNWASDDESTGLFDDPSPAPSTECGPRIRVP
RQLLDELELAARYRTEQRWSLLYRVLWRVAQGDSSARMVGDIDGSELHGRIKAVRREAHH
LHAFLRFSPLQTSDGPQHVAWFEPAHDVLPWAAGHFAERMGGNRWLIATPEEAVCWDGQQ
MYYTRPCPPQWRQLAQSAADPGGELWKAYYESTFNPARLNRGVLESNLPVRFWKNLPEGM
LIPQLMSRARAGAQRDGQAERVAARSGKRIGRDAKPAD