Protein Info for PGA1_c29000 in Phaeobacter inhibens DSM 17395

Annotation: inner membrane lipoprotein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF13441: Gly-zipper_YMGG" amino acids 4 to 79 (76 residues), 44.5 bits, see alignment E=1.9e-15 PF13488: Gly-zipper_Omp" amino acids 37 to 83 (47 residues), 38 bits, see alignment 1.8e-13 PF00691: OmpA" amino acids 113 to 208 (96 residues), 80.6 bits, see alignment E=1.4e-26

Best Hits

Swiss-Prot: 43% identical to YIAD_ECOLI: Probable lipoprotein YiaD (yiaD) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 69% identity to sit:TM1040_2448)

Predicted SEED Role

"Outer membrane protein assembly factor YaeT precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F030 at UniProt or InterPro

Protein Sequence (219 amino acids)

>PGA1_c29000 inner membrane lipoprotein (Phaeobacter inhibens DSM 17395)
MIQMKLTTAAIVAAGLGLTACTDPATIGTPGSKTQNGALIGGLIGAGVGAAANDSDRGLG
AVTGALVGAAAGSVIGNQLDAQERELRQSISNDGISIVNTGDRLIVSLPNDLTFATDSAA
VSPAVRSDLNKVASSLVRYPNSQVQVIGHTDSDGDAGYNQGLSERRANAVADQIQAGGVP
YNRVQIIGRGESQPVASNLTAEGKARNRRVEIVVIPQGA