Protein Info for PGA1_c28900 in Phaeobacter inhibens DSM 17395

Annotation: putative DMSO reductase anchor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 34 to 59 (26 residues), see Phobius details amino acids 80 to 100 (21 residues), see Phobius details amino acids 106 to 126 (21 residues), see Phobius details amino acids 138 to 155 (18 residues), see Phobius details amino acids 161 to 178 (18 residues), see Phobius details amino acids 234 to 253 (20 residues), see Phobius details amino acids 260 to 280 (21 residues), see Phobius details PF04976: DmsC" amino acids 49 to 156 (108 residues), 45.1 bits, see alignment E=4.7e-16

Best Hits

KEGG orthology group: K07308, anaerobic dimethyl sulfoxide reductase subunit C (DMSO reductase anchor subunit) (inferred from 72% identity to sil:SPO3557)

Predicted SEED Role

"Anaerobic dimethyl sulfoxide reductase chain C (EC 1.8.5.3)" (EC 1.8.5.3)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.8.5.3

Use Curated BLAST to search for 1.8.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F021 at UniProt or InterPro

Protein Sequence (295 amino acids)

>PGA1_c28900 putative DMSO reductase anchor subunit (Phaeobacter inhibens DSM 17395)
MHPAPSVILFTTLSGLGFGLLAFLGFGKPAVTGWVAFVFYAIAFGFAVGGLLASTFHLGR
PERAWRAFTQWKTSWLSREGICAVAALIVMGLFAFGAVFLDTHWWVLGWIGAALSLATVF
TTSMIYTQLKTIPRWNMSLTPVMFLSFSLAGGSLLAGAEALAPWLLAIAGSVQLAYWAKG
DQAFASSGTDMGTATGLGDRGTVRAFEPPHTGSNYLLREFVHVVGRKHAQKLRVIAFALG
FALPLICLILPVEGLMAKHLLAGIAVLLHIAGIAVSRWLFFAQAEHVVGLYYGKR