Protein Info for PGA1_c28890 in Phaeobacter inhibens DSM 17395

Annotation: polysulfide reductase chain B-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 264 PF13247: Fer4_11" amino acids 81 to 182 (102 residues), 78.7 bits, see alignment E=1.3e-25 PF13237: Fer4_10" amino acids 85 to 132 (48 residues), 35.9 bits, see alignment 2.3e-12 PF12837: Fer4_6" amino acids 113 to 135 (23 residues), 30.8 bits, see alignment (E = 7.8e-11) PF12797: Fer4_2" amino acids 113 to 133 (21 residues), 27.6 bits, see alignment (E = 7.8e-10) PF00037: Fer4" amino acids 115 to 136 (22 residues), 33 bits, see alignment (E = 1.5e-11) PF12798: Fer4_3" amino acids 121 to 135 (15 residues), 20 bits, see alignment (E = 3.7e-07)

Best Hits

KEGG orthology group: None (inferred from 89% identity to sil:SPO3558)

Predicted SEED Role

"Anaerobic dimethyl sulfoxide reductase chain B (EC 1.8.5.3)" (EC 1.8.5.3)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.8.5.3

Use Curated BLAST to search for 1.8.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DTY7 at UniProt or InterPro

Protein Sequence (264 amino acids)

>PGA1_c28890 polysulfide reductase chain B-like protein (Phaeobacter inhibens DSM 17395)
MTELPTKTDRKMGLVIDLDTCVGCHACVISCKGWNTENYGAPLSDQNAYGADPSGTFLNR
VHSYEVQPSPCASQPNPAAQLVHFPKSCLHCEDAPCVTVCPTGASYKRVEDGIVLVNESN
CIGCGLCAWSCPYGARELDLAEGVMKKCTLCVDRIYNENLEEVDRVPSCVRTCPAGARHF
GDLGDPDSDVSKLVAERGGMDLMPEMGTKPVNKYLPPRPKDQIEDQIDILAPLLAPVAED
PKGFLGWLDKALDKLPGQTSGGAS