Protein Info for HP15_283 in Marinobacter adhaerens HP15

Annotation: methionine biosynthesis protein MetW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 199 TIGR02081: methionine biosynthesis protein MetW" amino acids 2 to 195 (194 residues), 263.3 bits, see alignment E=5.7e-83 PF07021: MetW" amino acids 2 to 195 (194 residues), 267.3 bits, see alignment E=2.2e-83 PF13489: Methyltransf_23" amino acids 15 to 115 (101 residues), 38.6 bits, see alignment E=2.7e-13 PF13847: Methyltransf_31" amino acids 15 to 111 (97 residues), 42.2 bits, see alignment E=2.2e-14 PF13649: Methyltransf_25" amino acids 18 to 103 (86 residues), 42.2 bits, see alignment E=3.3e-14 PF08242: Methyltransf_12" amino acids 19 to 103 (85 residues), 36.9 bits, see alignment E=1.6e-12 PF08241: Methyltransf_11" amino acids 19 to 105 (87 residues), 46.8 bits, see alignment E=1.2e-15

Best Hits

KEGG orthology group: None (inferred from 92% identity to maq:Maqu_0531)

Predicted SEED Role

"Methionine biosynthesis protein MetW"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PL05 at UniProt or InterPro

Protein Sequence (199 amino acids)

>HP15_283 methionine biosynthesis protein MetW (Marinobacter adhaerens HP15)
MRPDLEIIQQWVQPGHHVLDLGCGDGTLLDFLQRERGASGFGLEINPDHITACMGRGVAV
IEQNLDTQGLGNFEDGSFDIVLMTQALQAVRRPDRVLDEMLRVGSEGIVTFPNFAHWRLR
WGLTLSGRMPESEALPYKWYNTPNIRLCTFKDFEALCRQKGIRIKSRRVVDGQHQNSWLA
RLWPNLLGEIAIYRITRET