Protein Info for PGA1_c28840 in Phaeobacter inhibens DSM 17395
Annotation: acetate kinase AckA
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 45% identical to ACKA_RHOPA: Acetate kinase (ackA) from Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
KEGG orthology group: None (inferred from 60% identity to dsh:Dshi_5006)Predicted SEED Role
"Acetate kinase (EC 2.7.2.1)" in subsystem Ethanolamine utilization or Fermentations: Lactate or Fermentations: Mixed acid or Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate or Threonine anaerobic catabolism gene cluster (EC 2.7.2.1)
MetaCyc Pathways
- superpathway of L-threonine metabolism (15/18 steps found)
- Bifidobacterium shunt (12/15 steps found)
- pyruvate fermentation to acetate II (3/3 steps found)
- superpathway of acetate utilization and formation (3/3 steps found)
- L-threonine degradation I (5/6 steps found)
- acetate and ATP formation from acetyl-CoA I (2/2 steps found)
- acetylene degradation (anaerobic) (4/5 steps found)
- ethanolamine utilization (4/5 steps found)
- hexitol fermentation to lactate, formate, ethanol and acetate (14/19 steps found)
- pyruvate fermentation to acetate and (S)-lactate I (3/4 steps found)
- pyruvate fermentation to acetate I (2/3 steps found)
- pyruvate fermentation to acetate IV (2/3 steps found)
- pyruvate fermentation to acetate VII (2/3 steps found)
- glycine degradation (reductive Stickland reaction) (1/2 steps found)
- reductive glycine pathway of autotrophic CO2 fixation (6/9 steps found)
- mixed acid fermentation (11/16 steps found)
- (S)-propane-1,2-diol degradation (3/5 steps found)
- superpathway of N-acetylneuraminate degradation (15/22 steps found)
- pyruvate fermentation to acetate and lactate II (2/4 steps found)
- acetyl-CoA fermentation to butanoate (4/7 steps found)
- superpathway of Clostridium acetobutylicum acidogenic fermentation (5/9 steps found)
- superpathway of fermentation (Chlamydomonas reinhardtii) (5/9 steps found)
- purine nucleobases degradation II (anaerobic) (15/24 steps found)
- methanogenesis from acetate (2/6 steps found)
- (S)-lactate fermentation to propanoate, acetate and hydrogen (7/13 steps found)
- lactate fermentation to acetate, CO2 and hydrogen (Desulfovibrionales) (3/8 steps found)
- L-lysine fermentation to acetate and butanoate (3/10 steps found)
- superpathway of L-alanine fermentation (Stickland reaction) (2/9 steps found)
- gallate degradation III (anaerobic) (3/11 steps found)
- superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (7/17 steps found)
- purine nucleobases degradation I (anaerobic) (5/15 steps found)
- superpathway of methanogenesis (2/21 steps found)
- superpathway of L-lysine degradation (10/43 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.7.2.1
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See I7DTY0 at UniProt or InterPro
Protein Sequence (386 amino acids)
>PGA1_c28840 acetate kinase AckA (Phaeobacter inhibens DSM 17395) MSPRSADNILILNAGSSSIKFAIFDTDLNQRLAGLAEGIGTPQSRLRIADTSRDSQLPTH AEALAAILAALPDHGLDPTQLAAVGHRVVHGGRKLTKPVRITPEIRAEIADCTPLAPLHN PHSLAAIDTMATTAPDLPQFASFDTSFHATNPEVATRYAIPRVEETKGIRRYGFHGLSYA SLVRRLPEISGAALPSRLLAFHLGNGASLCAIRNGQSVATTMGYSPLDGLTMGTRSGGID ANAVLRLVEDNGLDRTKAILNNESGLLGLSGGKSDMRNLMLDPSADSAFAIEHFCYWSLR HAGSLIAAMEGLDAIAFTGGIGENAVGVRARILRGLEWIGARMDVDANHARKSRLHAGSS KVAIWVVEAEEERQIAMDAQTLMGTP