Protein Info for PGA1_c28810 in Phaeobacter inhibens DSM 17395

Annotation: transcriptional regulator, GntR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 491 PF00392: GntR" amino acids 19 to 81 (63 residues), 50.9 bits, see alignment E=9.6e-18 PF00155: Aminotran_1_2" amino acids 162 to 451 (290 residues), 62.6 bits, see alignment E=3.8e-21

Best Hits

Swiss-Prot: 55% identical to TAUR_RHOCB: HTH-type transcriptional regulator TauR (tauR) from Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)

KEGG orthology group: K00375, GntR family transcriptional regulator / MocR family aminotransferase (inferred from 76% identity to sit:TM1040_0156)

Predicted SEED Role

"Transcriptional regulator, MocR family, putative Taurine regulator tauR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EQF3 at UniProt or InterPro

Protein Sequence (491 amino acids)

>PGA1_c28810 transcriptional regulator, GntR family (Phaeobacter inhibens DSM 17395)
MAISVDTFFLNPDAHGTLQAQIQEMIAEGILSGRLRVGEKLPSSRKLAAHLGISRITVTL
AYTELLANDYLISKGRSGYYVSENAPVPPSYAPSQKSADTVDWSSAIVGNYCGGDTPRKP
QDWRDYRYPFIYGQADASLFDHANWRLCALRALGQKDFAALTNDYFDQDDPLLVEYIARH
TLPRRGISARPEEILITLGAQNALWLVTQLLLGPGRKAALEDPTYYTLRDQLVYRGCEID
CLPVDHDGLPPDTIRDDTDVIFTTPSHQSPTTATMPMARRKQLLERAREIDAVIVEDDYE
FEMSFLGAPSPALKSLDADGRVVYVGSFSKSLFPGLRLGYLVGSEPFIRQARALRANVLR
HPPGHVQRTVAYFLSLGHYDAQIRRMAKVLHDRRCVIEDAVTHHGLSVAGVGVYGGSSLW
MRADEGVDTAAVAQSLKATSVLIEPGAPFFAAEHRKQNYYRLGYSSIPSNRIAPGLALIA
EALRPSRAKAG