Protein Info for Psest_2889 in Pseudomonas stutzeri RCH2

Annotation: Predicted flavoprotein involved in K+ transport

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 626 PF07992: Pyr_redox_2" amino acids 192 to 388 (197 residues), 45 bits, see alignment E=2e-15 PF13738: Pyr_redox_3" amino acids 193 to 424 (232 residues), 60.6 bits, see alignment E=3e-20 PF00743: FMO-like" amino acids 246 to 391 (146 residues), 62.4 bits, see alignment E=6e-21 PF13434: Lys_Orn_oxgnase" amino acids 277 to 406 (130 residues), 21.6 bits, see alignment E=2.2e-08

Best Hits

KEGG orthology group: K07222, putative flavoprotein involved in K+ transport (inferred from 66% identity to pna:Pnap_0619)

Predicted SEED Role

"Flavin-containing monooxygenase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GKV5 at UniProt or InterPro

Protein Sequence (626 amino acids)

>Psest_2889 Predicted flavoprotein involved in K+ transport (Pseudomonas stutzeri RCH2)
MRPSNDVPFDLKTDNGSDPGGDSQATATRSPTEQLAAWVERLGQRLAQRDIDGALELFVD
DCHWRDLVLFSWNLITLEGKADIRDMLESRLEATRPDNWKLEGEASLTDGVLEGWISLET
DVARGKGYVRLKDGLCWTLLTTMRELKGHEEPLGRRRPLGAEHGHGLADKRNWLEKRRDE
EAALGITEQPYCLVIGGGQGGLGLGARLKRLGVPTLIVDKAERPGDQWRGRYKSLCLHDP
VWYDHMPYLPFPDHWPIFTPKDQIGDWLEMYAKVMELNYWAKTECVKASFDEAEGRWTVE
VLRDGKPMTLKPAQLILATGMSGVPNVPVYPGAETFAGQQHHSSQHPGGGAWRGKRAVVI
GANNSAHDICADLVENGADVTMVQRSSTHIVRSDTLMDVVFGPLYSEDAVESGLTTEKAD
MLFASIPYKVLPQFHRQAFEQVKERDKAFYDRLAAAGFMLDFGDDESGLFLKYVRRGSGY
YIDVGACELIANGTIKLKSGPGLGVDHIEADAVVLNDGSRLPADLIVYATGYGSMNGWAA
RLISQEVADKVGRCWGLGSGTTKDPGPYEGELRNMWKPTQQQNLWFHGGNLHQSRHYSLY
LALQLKARFEGLDTSVYKLAPSYHRG