Protein Info for Psest_0284 in Pseudomonas stutzeri RCH2

Annotation: pyridoxal phosphate enzyme, YggS family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 TIGR00044: pyridoxal phosphate enzyme, YggS family" amino acids 1 to 223 (223 residues), 250.3 bits, see alignment E=8.8e-79 PF01168: Ala_racemase_N" amino acids 9 to 223 (215 residues), 98.1 bits, see alignment E=3.2e-32

Best Hits

Swiss-Prot: 80% identical to PLPHP_PSEAE: Pyridoxal phosphate homeostasis protein (PA0394) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K06997, (no description) (inferred from 89% identity to psa:PST_3966)

Predicted SEED Role

"Hypothetical protein YggS, proline synthase co-transcribed bacterial homolog PROSC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GHK1 at UniProt or InterPro

Protein Sequence (229 amino acids)

>Psest_0284 pyridoxal phosphate enzyme, YggS family (Pseudomonas stutzeri RCH2)
MSTIEKNIAKVAARIREAAQAVDRDPATVGLLAVSKTQPAAAIREAAAGGILDFGENYLQ
EALDKQAELSDLSLAWHFIGPIQSNKTKSIAERFDWVHSVDRLKIAQRLSDQRPAELPPL
NICLQVNVSGEASKSGCAPEELLQLAQAVAAMPQLRLRGLMCIPAPSEDPAEQRAAFARL
RALRDELPLTLDTLSMGMSQDLEAAIAEGATWVRIGTALFGARDYGRPQ