Protein Info for HP15_2770 in Marinobacter adhaerens HP15

Annotation: permease for cytosine/purines uracil thiamine allantoin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 427 transmembrane" amino acids 25 to 46 (22 residues), see Phobius details amino acids 57 to 80 (24 residues), see Phobius details amino acids 101 to 126 (26 residues), see Phobius details amino acids 137 to 156 (20 residues), see Phobius details amino acids 164 to 187 (24 residues), see Phobius details amino acids 200 to 220 (21 residues), see Phobius details amino acids 232 to 257 (26 residues), see Phobius details amino acids 264 to 285 (22 residues), see Phobius details amino acids 311 to 328 (18 residues), see Phobius details amino acids 334 to 355 (22 residues), see Phobius details amino acids 367 to 386 (20 residues), see Phobius details amino acids 392 to 412 (21 residues), see Phobius details PF02133: Transp_cyt_pur" amino acids 16 to 390 (375 residues), 115 bits, see alignment E=2e-37

Best Hits

KEGG orthology group: K10974, cytosine permease (inferred from 65% identity to pmk:MDS_1550)

Predicted SEED Role

"Cytosine permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PLE3 at UniProt or InterPro

Protein Sequence (427 amino acids)

>HP15_2770 permease for cytosine/purines uracil thiamine allantoin (Marinobacter adhaerens HP15)
MTTEPTPKEQDYPLSPVPMDQRKSVWSMGLVLLGFTFFTATMWAGGSVGVAFDFSTMLMV
LAVGNLLLGLYAAGLGYIAAKTGLNTALMSRFTFGELGSKLSDFILGFTQIGWYAWGTAT
MAILLVKLTGMPEGMTTPLMVLFGFAFCVTAFIGYQGLEWLSRVAVPAMIILVAVSMSIA
TSDAGGLSGLLAITPTNEMSVAAAITLVFGTFVSGGTQATNWTRFAKSGKTAVIATLLAF
FLGNGLMTLIGALGALVYQQADIVDIMVAQGLATLGILMLFLNLWTTQDNTVYNFAVAGC
NLIRTRRRKSVTIAGAAIGTVLAVLGMYEWLIPFLVLLGTFIPPIGGVIMASYFVGYKRQ
YPDLTTVTLPAFNFPGLAAYAIGSAAAYTSPWIAPIVGVLVAALSYSIILVVSEAVRERK
AQVMGAI