Protein Info for Psest_2880 in Pseudomonas stutzeri RCH2

Annotation: Glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 371 PF13579: Glyco_trans_4_4" amino acids 15 to 166 (152 residues), 47.5 bits, see alignment E=7.8e-16 PF13439: Glyco_transf_4" amino acids 15 to 176 (162 residues), 76.1 bits, see alignment E=1.1e-24 PF00534: Glycos_transf_1" amino acids 187 to 332 (146 residues), 76.8 bits, see alignment E=4.6e-25 PF13692: Glyco_trans_1_4" amino acids 199 to 326 (128 residues), 76.3 bits, see alignment E=8.9e-25 PF13524: Glyco_trans_1_2" amino acids 214 to 353 (140 residues), 34.5 bits, see alignment E=5.7e-12

Best Hits

KEGG orthology group: K14335, alpha-1,6-mannosyltransferase [EC: 2.4.1.-] (inferred from 96% identity to psa:PST_1500)

Predicted SEED Role

"Glycosyltransferase"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GPY8 at UniProt or InterPro

Protein Sequence (371 amino acids)

>Psest_2880 Glycosyltransferase (Pseudomonas stutzeri RCH2)
MHIADMTMFYAPASGGVRTYLEAKHRRLQLYSGVRHSILVPGGDYSHNDGLYEVPAPILP
FGKGYRFPIRRAPWRNLLRSLRPDLIEVGDPYMTAWAALDAGRRLNIPVIGFYHSDLPLL
VSNRIGNWLGTNLNGYVSKLYGSFDRVLAPSEVMADKLMHLGVKNVFVQPLGVDLDTFCP
ERRDPDLRHELGLADDTRLMIFAGRGSREKNLHILLDTARQLGKPYHLLLVGSSMPQRVP
DNVTVIDRFCCASEVARYVASSDVLLHAGNQETFGLVALEAMACGIPVVAARAGALPELV
PFYSGRLCRPLDAKAMAHTVRELFEDDPRLLGQQARQHVEAHHAWDAVVAGLLAHYHAVL
GTVELPVAVHG