Protein Info for HP15_2766 in Marinobacter adhaerens HP15

Annotation: sensory box/GGDEF family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 39 to 59 (21 residues), see Phobius details amino acids 65 to 85 (21 residues), see Phobius details amino acids 91 to 109 (19 residues), see Phobius details amino acids 114 to 134 (21 residues), see Phobius details amino acids 141 to 158 (18 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 178 to 343 (166 residues), 141.4 bits, see alignment E=1.1e-45 PF00990: GGDEF" amino acids 180 to 339 (160 residues), 137.2 bits, see alignment E=2.3e-44

Best Hits

KEGG orthology group: None (inferred from 44% identity to amc:MADE_03836)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PLD9 at UniProt or InterPro

Protein Sequence (344 amino acids)

>HP15_2766 sensory box/GGDEF family protein (Marinobacter adhaerens HP15)
MLMLRLSIVVGGILISLFMIGDLQLIPPDLTSAYTTNRALIQLPVLAGLLAFTFVPQFLR
FAQTAFLATVLSITYANYYLIHVAWEQAAFSFPYEGTLLYAFFGFFVFGMKFHYALTAMV
LSSLGFVGLMLMDSVYGERTWMNAGFVAGSLFVGVIGRHRIDRLLGQLQEANEQLVGLST
IDELTDLFNRRALMSESGRLFARQRRSNQRLAVLMMDLDHFKQFNDHYGHQQGDQAIRQQ
ADIMRQVFKRQTDILGRYGGEEFMAVIEGEDADRFELLAAEVLKQWQDRAVSNEDSPDSK
ELSCSIGICQGLATEFDSIDEMIRMADEALYRAKKQGRARYVMA