Protein Info for Psest_2876 in Pseudomonas stutzeri RCH2

Annotation: Ferredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 107 PF00037: Fer4" amino acids 34 to 55 (22 residues), 26.1 bits, see alignment 2e-09 PF11953: DUF3470" amino acids 66 to 107 (42 residues), 82.5 bits, see alignment E=5.8e-27

Best Hits

Swiss-Prot: 100% identical to FER_PSEST: Ferredoxin 1 from Pseudomonas stutzeri

KEGG orthology group: K05524, ferredoxin (inferred from 95% identity to pmy:Pmen_3019)

Predicted SEED Role

"4Fe-4S ferredoxin, iron-sulfur binding"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GPR8 at UniProt or InterPro

Protein Sequence (107 amino acids)

>Psest_2876 Ferredoxin (Pseudomonas stutzeri RCH2)
MTFVVTDNCIKCKYTDCVEVCPVDCFYEGPNFLVIHPDECIDCALCEPECPAQAIFSEDE
VPEDQQEFIELNADLAEVWPNITEKKDALADAEEWDGVKDKLQYLER