Protein Info for Psest_2873 in Pseudomonas stutzeri RCH2

Annotation: competence/damage-inducible protein CinA C-terminal domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02464: CinA
  • amino acids 4 to 154 (151 residues), 184.1 bits, E=6.7e-59
• TIGR00199: amidohydrolase, PncC family
  • amino acids 10 to 153 (144 residues), 151.3 bits, E=1.1e-48

Best Hits

Swiss-Prot: 75% identical to PNCC_PSEPU: Nicotinamide-nucleotide amidohydrolase PncC (pncC) from Pseudomonas putida

KEGG orthology group: K03743, (no description) (inferred from 75% identity to ppw:PputW619_4031)

MetaCyc: 54% identical to NMN aminohydrolase (Escherichia coli K-12 substr. MG1655)
Nicotinamide-nucleotide amidase. [EC: 3.5.1.42]

Predicted SEED Role

"C-terminal domain of CinA type S; Protein Implicated in DNA repair function with RecA and MutS"

MetaCyc Pathways

• NAD salvage pathway II (PNC IV cycle) (4/5 steps found)

KEGG Metabolic Maps

• Nicotinate and nicotinamide metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.42

Sequence Analysis Tools

See L0GNJ8 at UniProt or InterPro

Protein Sequence (165 amino acids)

>Psest_2873 competence/damage-inducible protein CinA C-terminal domain (Pseudomonas stutzeri RCH2)
MNLTELAARLGEELQRLGAQVTTAESCTGGGIAEAITRIAGSSAWFEAGYITYSNAQKTR
QLGVPAELFEQVGAVSAEVVQAMVHGARQNSGARFAVAVSGVAGPSGGTAEKPVGTVWIA
WADGNQVHAQRHLFSGDRQAVREQTVAAALQGLIALAVGEKPVRG