Protein Info for Psest_2870 in Pseudomonas stutzeri RCH2

Annotation: TIGR00730 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 PF18306: LDcluster4" amino acids 86 to 199 (114 residues), 49.1 bits, see alignment E=4.7e-17 TIGR00730: TIGR00730 family protein" amino acids 87 to 265 (179 residues), 96.5 bits, see alignment E=7.7e-32 PF03641: Lysine_decarbox" amino acids 129 to 262 (134 residues), 105.5 bits, see alignment E=2.6e-34

Best Hits

KEGG orthology group: K06966, (no description) (inferred from 93% identity to psa:PST_1510)

Predicted SEED Role

"Decarboxylase family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GPX8 at UniProt or InterPro

Protein Sequence (363 amino acids)

>Psest_2870 TIGR00730 family protein (Pseudomonas stutzeri RCH2)
MSFDTDDYLSRHFKTSGAELESKIDELVAMVVSETSPNLPLYREMLVTVTRMAQADRSRW
DAKILLQTMREMEHAFSRLDQFKRRRKVTVFGSARTPVEHPLYALARQLGATLAHYNFMV
ITGAGGGIMAAAHEGAGRDNSLGLNITLPFEQHPNPTVGGTDNLLSFHFFFVRKLFFIKE
ADALVLCPGGFGTLDEALEVLTLIQTGKSPLVPVVLLDEPGGTYWKDALQFMRGQLEENR
YILPSDMRLMRLVDDADEAAREIANFYRNFHSSRWLKDRFVLRMNHPLNQQAMEYLNDEF
TDLCVKGEFEQQNCCESELDEPELQRLPRLSFVFNGRNHGRLRELTDFVNEPANWAAPLA
TED