Protein Info for HP15_2758 in Marinobacter adhaerens HP15

Annotation: conserved hypothetical protein, membrane

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 154 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details transmembrane" amino acids 34 to 35 (2 residues), see Phobius details amino acids 50 to 71 (22 residues), see Phobius details amino acids 92 to 112 (21 residues), see Phobius details amino acids 124 to 144 (21 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 77% identity to maq:Maqu_2932)

Predicted SEED Role

"N-linked glycosylation glycosyltransferase PglG" in subsystem N-linked Glycosylation in Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PLD1 at UniProt or InterPro

Protein Sequence (154 amino acids)

>HP15_2758 conserved hypothetical protein, membrane (Marinobacter adhaerens HP15)
MVNMLAAIPVRALFARLFSLVFFVLAFTLVSATVLEVIAALQSGQQLMQALIKGVNGSII
ALAVYELAMVIRSEYSGRSESHDVITMMRRTLPRFIGTVCVAMSLEGLIMIIKYSQLELA
GNLYYPVAIIVSTALLLASLGLFLKMAPRDQAGP