Protein Info for HP15_2746 in Marinobacter adhaerens HP15

Annotation: nitroreductase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00881: Nitroreductase
  • amino acids 8 to 184 (177 residues), 89 bits, E=2.1e-29

Best Hits

KEGG orthology group: None (inferred from 80% identity to maq:Maqu_1067)

Predicted SEED Role

"Oxygen-insensitive NAD(P)H nitroreductase (EC 1.-.-.-) / Dihydropteridine reductase (EC 1.5.1.34)" in subsystem Pterin biosynthesis (EC 1.-.-.-, EC 1.5.1.34)

MetaCyc Pathways

• tetrahydropteridine recycling (2/2 steps found)
• L-phenylalanine degradation V (2/3 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Carotenoid biosynthesis - General
• Folate biosynthesis
• Insect hormone biosynthesis
• Nucleotide sugars metabolism
• Porphyrin and chlorophyll metabolism
• Puromycin biosynthesis
• Trinitrotoluene degradation
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.- or 1.5.1.34

Sequence Analysis Tools

See E4PKN4 at UniProt or InterPro

Protein Sequence (208 amino acids)

>HP15_2746 nitroreductase family protein (Marinobacter adhaerens HP15)
MNIHEALDWRYAVREFSPEKLGAHTVETLVDAARKSASSYGLQPYKILVVESKSVRQDLL
AYSFGQQKVLDCSHLIVFAAQTDIGDHTVDRYVTQFVKTRDVPAQDISGYVAHMKEALAA
KSREEKRVWAHQQAYIALGTLLTAAASMRVDSCPMTGFDHQAYDDVLGLAKLGLETTAIV
ALGYRSARDRSSGLPKVRFDYGDMVISV