Protein Info for PGA1_c28440 in Phaeobacter inhibens DSM 17395

Annotation: putative transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 205 PF13560: HTH_31" amino acids 21 to 75 (55 residues), 36.4 bits, see alignment E=7.9e-13 PF01381: HTH_3" amino acids 25 to 79 (55 residues), 49.1 bits, see alignment E=6.9e-17 PF07883: Cupin_2" amino acids 123 to 190 (68 residues), 57.7 bits, see alignment E=1.2e-19

Best Hits

KEGG orthology group: None (inferred from 70% identity to jan:Jann_2046)

Predicted SEED Role

"Transcriptional regulator, MerR family" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F2B7 at UniProt or InterPro

Protein Sequence (205 amino acids)

>PGA1_c28440 putative transcriptional regulator (Phaeobacter inhibens DSM 17395)
MPQTSATPKPAKTRSSPGPMLGALIRKRRKQMGLTLQALCDTAGVSVGYLSQVERDNATP
TLGTLAQIASALEVGLEYFIATPKPSDALTRATTRTQFSLAGSSITYEALGAQFPGAELS
SYILHVPPGYVSEEVSHEGEEMLYVLEGEINQSLDGQVFRLQVGDSLHYSGLTSHSWSNP
TEETARLLWTGTLSVLHSKNTPNLP