Protein Info for PGA1_c28390 in Phaeobacter inhibens DSM 17395

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

No protein families (PFam or TIGRFam), signal peptides, or transmembrane helices were found in this protein.

Best Hits

KEGG orthology group: None (inferred from 74% identity to sit:TM1040_2719)

Predicted SEED Role

"FIG01073220: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F2B3 at UniProt or InterPro

Protein Sequence (179 amino acids)

>PGA1_c28390 hypothetical protein (Phaeobacter inhibens DSM 17395)
MPDNRLPEDISETVSVPLSTEALRHFTDALAAATTAEAAYDALCVLTKATVGAKLFTVMT
VDMTAMLACRTYTDDPENYPTSGTKPIEMNDWFEIVHGQHCSFVANTLEDIDQVFPDAEL
IGALGCGSVINLPVLIDGELAATINILHEPGYYTESRVEAAKALLTLPAMATLAFARQL